Last updated 2026-07-20
- Went public on TASE (TNDO), Oct 2021
- Acquired Cloud of Things, Nov 2022
- Raised Undisclosed Round led by Jerusalem Post Group, Mar 2026
Total raised
—
Stage
Public
Founded
2017
Headcount
34
HQ
Or Yehuda, Israel
Sector
Energy Tech
About
Tondo Smart is an Israeli company that develops AI-driven sensing and control platforms for smart cities and critical infrastructure. Their technology turns existing infrastructure, such as streetlights, into a secure, scalable data and control platform for real-time monitoring, adaptive control, and predictive maintenance. Tondo Smart's solutions include smart lighting, drone detection (Drone IQ™), wire and electricity theft detection, electrical grid monitoring, and water metering and flood sensing. The company's platform employs edge computing and predictive analytics to address operational challenges in urban environments and has dual-use functionality for both civilian and defense applications. Tondo Smart is publicly traded on the Tel Aviv Stock Exchange.
Funding history · 1 round · — total
2 events/rounds · — Total Funding
Mar 2026
★ Jerusalem Post GroupExisting shareholders
Acquisitions · 1
Nov 2022
Cloud of Things
Undisclosed
Headcount over time
34 employees (2026-09) · 1 point
Offices
Or Yehuda, Israel · HQ / main office
Q&A
- What is Tondo Smart's primary business?
- Tondo Smart manufactures smart lighting solutions for smart cities, including products for streets, roadways, parking lots, commercial buildings, and public transportation.
- When did Tondo Smart go public?
- Tondo Smart went public on the TASE in October 2021.
- Which company acquired Cloud of Things?
- Tondo Smart acquired Cloud of Things in November 2022.
- What was a significant funding event for Tondo Smart in 2024?
- In January 2024, Tondo Smart received a grant of $420,000 from the Israel Innovation Authority.
- Who took a strategic stake in Tondo Smart in March 2026?
- The Jerusalem Post Group took a strategic stake in Tondo Smart in March 2026.
- What was a key partnership announced by Tondo Smart in September 2023?
- In September 2023, Tondo Smart signed a strategic partnership with a US fiber optics company.
- How many employees does Tondo Smart have?
- Tondo Smart has 11-50 employees.
- Who is the Founder and CEO of Tondo Smart?
- Guy Saadi is the Founder and CEO of Tondo Smart.
Team · 12
Guy Saadi
Founder · CEO & Director
Micha Ben Ezra
Founder · Chief Operating Officer & Director
Yair Gamliel
Chairman
Gilad Babchuk
President and Board Chair, VP of Strategy & Director
Barak Ronen
CFO
Philip Desautels
Chief Product Officer
Marissa Wright
Chief Revenue Officer
Eliav Gnessin
CTO
Tali Fleinman-Frosh
VP Marketing
Ron Asher
Director
Anit Portman
Independent Director
Rony Tzubery
Independent Director
Sectors & technology
Primary sector
Energy Tech
Sub-sectors
Climate TechEnergy TransitionEco-Efficient Energy UsageEnergy TechEnergy Consumption & Efficiency
Technologies
SensingPlatforms & InterfacesMobileCommunicationsIOT
Target customers
Transportation & LogisticsTransportation InfrastructureRoad & RailReal Estate & ConstructionManagementCommercialEnterprise & Professional ServicesEnterprisesGovernment & CityMunicipalities
Business model
B2BB2G
Highlights
Climate TechIIA SupportedVerified
Tags
cloud-platformconsumerscommercial-sitesenergy-usagereal-timesafetyclimate-techlightinglocation-basediotmunicipalitiesconnectivitysensorssmart-citysmart-mobilityparkingtrafficenergy-savingenergytechenergy-efficiency5g-networks
Full data — links, identifiers, deals & radar signals (jobs, patents, research, more)
External links
| Website | tondo-ii.com |
|---|---|
| linkedin.com/company/11280649 | |
| YouTube | youtube.com/channel/UCLYODVQxESoU-VtoVCpGLtQ |
Identifiers & details
| Legal name | TONDO SMART LTD |
|---|---|
| Founded | 2017-9 |
| Employees (exact) | 34 |
| Market cap | $15.4M |
| Status reason | Public on TASE on Oct 2021; |
Acquisitions & public offerings
| Acquired | Date | Amount |
|---|---|---|
| Cloud of Things | 2022-11 |
| Type | Date | Exchange | Ticker | Amount |
|---|---|---|---|---|
| IPO | 2021-10 | TASE | TNDO |
Radar intelligence
Patents
| EPO | 4 |
|---|
Web history (Wayback)
| Domain | tondo-ii.com |
|---|
Certificate / subdomain footprint
| Subdomains | 2 |
|---|
Israeli Companies Registrar (רשם החברות / ICA)
| Registrar # (ח.פ.) | 515876167 |
|---|---|
| Status | פעילה |
| Corp type | ישראלית חברה ציבורית |
| Incorporated | 2018-07-17 |
| Purpose | לעסוק בכל עיסוק חוקי |
| Liability | מוגבלת |
| In violation (unfiled) | no |
| Last annual report | 2020 |
| Active charges / liens | 0 |
| Registry events | 0 |
| Registered address | היוצרים 5 אור יהודה |